PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc08321.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 234aa    MW: 25788.6 Da    PI: 7.0094
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc08321.1.g00010.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS214.94.2e-661923480298
                          GRAS  80 alklfsevsPilkfshltaNqaIleavegeervHiiDfdi....sqGlQWpaLlqaLasRpegpp.slRiTgvgspesgsk 155
                                   al l +e++P+l+f+h +aN  Ilea+ege+ vH++D+++    ++G QW  Ll+ L +R++g+p ++RiTgvg+      
  Zjn_sc08321.1.g00010.1.am.mk  19 ALALAYELCPYLRFAHYVANASILEAFEGESNVHVVDLGMtlglEHGHQWRRLLDGLKNRAGGKPaRVRITGVGA----PL 95 
                                   556779*******************************97622226889*************77666*********....99 PP

                          GRAS 156 eeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsP 236
                                   ++++++g+ L+ +A++lgv +ef++ v ++le+l++++L v+ +Ea+a+n++l+lh +++es    +   +vL+++++lsP
  Zjn_sc08321.1.g00010.1.am.mk  96 DTMKAVGRELEAYAATLGVFLEFRA-VDRSLESLHIDDLGVRGDEAVAINSILELHCVVKESRGALN---SVLQTIRKLSP 172
                                   *************************.799******************************88877777...8********** PP

                          GRAS 237 kvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                                   k +v+veq+a hn++ Fl rf+eal+yy+alfd+l+a lpr +  r+ vE++ +g ei+nvv
  Zjn_sc08321.1.g00010.1.am.mk 173 KAFVLVEQDAGHNGPFFLGRFMEALHYYAALFDALDAALPRYDARRARVEQFHFGAEIRNVV 234
                                   ************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.7791234IPR005202Transcription factor GRAS
PfamPF035141.5E-6319234IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MAFCIPRLCA GRDGTRGEAL ALAYELCPYL RFAHYVANAS ILEAFEGESN VHVVDLGMTL  60
GLEHGHQWRR LLDGLKNRAG GKPARVRITG VGAPLDTMKA VGRELEAYAA TLGVFLEFRA  120
VDRSLESLHI DDLGVRGDEA VAINSILELH CVVKESRGAL NSVLQTIRKL SPKAFVLVEQ  180
DAGHNGPFFL GRFMEALHYY AALFDALDAA LPRYDARRAR VEQFHFGAEI RNVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-412723487296GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970957.11e-147PREDICTED: DELLA protein RGL1-like
TrEMBLK3XGD91e-147K3XGD9_SETIT; Uncharacterized protein
STRINGSi000959m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-38RGA-like 1